DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP004770

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_318046.3 Gene:AgaP_AGAP004770 / 1278456 VectorBaseID:AGAP004770 Length:259 Species:Anopheles gambiae


Alignment Length:269 Identity:83/269 - (30%)
Similarity:124/269 - (46%) Gaps:56/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |:||||...:...|:...::...|     :.||.|.|.|:|:|:|.||                 
Mosquito    30 RIVGGHEIDIGAAPFQASVQSHGV-----HVCGGSIIHQQWVLSAGHC----------------- 72

  Fly   196 RDTDPDCENDLNGVRECAPPHIR----VTIDRILPHAQYSE---LNYRNDIALLRLSRPVNWLQM 253
            ...:|   |.|: ||..:..|.:    |.::..:.|..|.|   ::|  |::||||.:.:.:  .
Mosquito    73 SSKEP---NSLS-VRVASIHHNQGGQIVNVEESIRHPLYDEQLIIDY--DVSLLRLEQCLTF--S 129

  Fly   254 QNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAM-LHIQPQDQCQEAFYKDTKI 317
            .|::.:.||.|...:.:   |:...|||||.|::...|..:.:|. :.:.....||.| |.....
Mosquito   130 PNVQAIRLPMQDEFFQD---GTVCVVSGWGATQNPVESSDRLRATDVPLVNHAVCQTA-YISAAA 190

  Fly   318 TLADSQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYT 379
            |:.|..:|||   |  |.|:|.|||||||..| ||        |.||||.....|....|.|:|:
Mosquito   191 TITDRMICAGYFSG--GRDACQGDSGGPLYYE-NT--------LIGVVSWRTGDCAEVNFPGVYS 244

  Fly   380 RVSSYMDWI 388
            ||:|...||
Mosquito   245 RVASVRAWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 81/267 (30%)
Tryp_SPc 133..391 CDD:238113 82/267 (31%)
AgaP_AGAP004770XP_318046.3 Tryp_SPc 30..253 CDD:214473 81/267 (30%)
Tryp_SPc 31..256 CDD:238113 82/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.