DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP006672

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_316708.4 Gene:AgaP_AGAP006672 / 1277262 VectorBaseID:AGAP006672 Length:327 Species:Anopheles gambiae


Alignment Length:323 Identity:95/323 - (29%)
Similarity:146/323 - (45%) Gaps:67/323 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 PPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPW 145
            ||:.|           |.:.|........||...||:         |...::.||......:||.
Mosquito    49 PPVPP-----------SASILSAASTALYRPKLIIDR---------ASLSKVAGGTVAKNDQFPH 93

  Fly   146 --TTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNG 208
              :.:|.:   :.|.|..||.|.:|.|::||||||::  |......:.|:             :.
Mosquito    94 LVSIILIF---ADGSDTLCGGSILADRFILTAAHCLY--GMQEATIVPGQ-------------SV 140

  Fly   209 VRECAPPHIRVTI-----DRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRY 268
            ::...||.| ||:     |.|| |..|..::..|||||:||.:|:.:  ...::|:.||.....|
Mosquito   141 IQIPFPPDI-VTVAIKPADTIL-HPGYDPVDILNDIALIRLPQPLTF--SARVQPIRLPSWTNSY 201

  Fly   269 ANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQ-------PQDQCQEAFYKDTKITLADSQMCA 326
            .: |.|..:.|||||...:...:::..:..|.::       |...|...:..    .:.|.|:|.
Mosquito   202 VD-LTGYDSIVSGWGAQSNDDYAELVDEMRLDLRFATNTIVPNAVCHRVYGS----IIRDQQICV 261

  Fly   327 GGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGR-KHCGTALFSGIYTRVSSYMDWI 388
            .||.|.:.|.|||||||||:.:   |.|...: |:||.|. ..|...: .|:|||||||::||
Mosquito   262 AGEGGRNPCQGDSGGPLTVKFD---GQRLTQV-GIVSYGSVLGCENGV-PGVYTRVSSYVEWI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/271 (31%)
Tryp_SPc 133..391 CDD:238113 85/271 (31%)
AgaP_AGAP006672XP_316708.4 Tryp_SPc 79..319 CDD:214473 83/271 (31%)
Tryp_SPc 80..319 CDD:238113 83/270 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.