DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP006539

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_316577.4 Gene:AgaP_AGAP006539 / 1277138 VectorBaseID:AGAP006539 Length:270 Species:Anopheles gambiae


Alignment Length:289 Identity:81/289 - (28%)
Similarity:136/289 - (47%) Gaps:53/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQR 170
            |:|....||.|:             |:|.|.:..:.::|:  :|.....:||  ::||.|.:::.
Mosquito    23 RSTIVDESGPDR-------------RIVNGTDASILDYPF--MLSLRGSTGG--HSCGGSILSEL 70

  Fly   171 WLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELN- 234
            |.:|||||:.:....|....:|..|...|.|  :.:.|:.:            ::.|.||...| 
Mosquito    71 WAMTAAHCVSSTTTYLQTIQVGRTNISRDVD--DSVYGIAQ------------VIAHPQYDSRNS 121

  Fly   235 YRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK-QKAM 298
            :.||||||:|.||:  :..::::||.||.......:.|......:.|||...:.||:... |:..
Mosquito   122 HLNDIALLKLQRPI--VFSESVQPVRLPAPMFEVEDDLDDLGVTLIGWGLLATGGSAPATLQRVD 184

  Fly   299 LHIQPQDQCQEAFYKDTKITLADSQMCA---GGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAG 360
            .::.|.::| .|.:..   |:..|.:||   ||  |...|||||||||.         .:....|
Mosquito   185 YYVVPNEEC-NAIHTG---TIYPSHICAAIPGG--GKGQCSGDSGGPLL---------HHGVQVG 234

  Fly   361 VVSIGRKHCGTALFSGIYTRVSSYMDWIE 389
            :||...|.|..|.:.|:.|:||.::::|:
Mosquito   235 IVSWSVKPCAVAPYPGVLTKVSHHLEFIQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 75/261 (29%)
Tryp_SPc 133..391 CDD:238113 75/262 (29%)
AgaP_AGAP006539XP_316577.4 Tryp_SPc 35..262 CDD:214473 75/261 (29%)
Tryp_SPc 36..265 CDD:238113 75/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.