DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:299 Identity:84/299 - (28%)
Similarity:125/299 - (41%) Gaps:50/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGK 158
            ||.:...|.|:.......|.|              ..|:|.|....|.:||:...|... |..|:
Mosquito     4 ATCALALLALVASVAQAAPRG--------------GMRVVNGETAKLGQFPYQVRLTLH-VGNGQ 53

  Fly   159 DYACGASFIAQRWLLTAAHCIHTMGRNLTAAILG--EWNRDTDPDCENDLNGVRECAPPHIRVTI 221
            ...||.|.:.:.|:|||.||:  |........||  :::.:|     ||...|.|..        
Mosquito    54 QALCGGSLLNEEWVLTAGHCV--MLAKSVEVHLGAVDFSDNT-----NDGRLVLEST-------- 103

  Fly   222 DRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTE 286
             ....|.:|:.|...||:||::|...|.:  .:.::||.||..    ....||....|||||...
Mosquito   104 -EFFKHEKYNPLFVANDVALVKLPSKVEF--SERVQPVRLPTG----DEDFAGREVVVSGWGLMV 161

  Fly   287 SSGS-SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTA 350
            :.|. ::..|.|.|.:.|..|||:.|   :.:.:..|.:||.||.....|:|||||||.:..:..
Mosquito   162 NGGQVAQELQYATLKVIPNKQCQKTF---SPLLVRKSTLCAVGEELRSPCNGDSGGPLVLAEDKT 223

  Fly   351 SGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIE 389
                   |.||||.|............:.||:::.||::
Mosquito   224 -------LVGVVSFGHAQGCDKGHPAAFARVTAFRDWVK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/259 (30%)
Tryp_SPc 133..391 CDD:238113 77/260 (30%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 77/259 (30%)
Tryp_SPc 28..257 CDD:238113 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.