DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP006192

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_316257.4 Gene:AgaP_AGAP006192 / 1276857 VectorBaseID:AGAP006192 Length:346 Species:Anopheles gambiae


Alignment Length:284 Identity:77/284 - (27%)
Similarity:119/284 - (41%) Gaps:36/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSFR---LVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRN 185
            ||.....:   :.||..:....:||...:.:........|.||.:.|.:..:|||.||:....|.
Mosquito    26 CGQVQVLKQGLIFGGTASTPGMWPWHVAVFHRESIRRTSYKCGGTIINRDTVLTAYHCVVENQRP 90

  Fly   186 LTAAIL----GEWNRDT-DPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLS 245
            :.|..|    |.::.|. .|..:.  |.|.:...|          |.|  |...:.:|||:|::.
Mosquito    91 IAAGRLVARAGLFDLDVGGPTVQE--NRVFDVISP----------PGA--SARTFDDDIAILKMQ 141

  Fly   246 RPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA 310
              ..:.....::|||:...| :...||.|:...|.|||.||.|.:|...::|.:.:...:.|..:
Mosquito   142 --TQFTYDDYVQPVCIRSVR-QDIGQLVGAYGTVVGWGWTEQSTTSAELRQANVPVVSAEDCLAS 203

  Fly   311 FYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVS---IGRKHCGTA 372
            ........|.....|||...|..||:|||||.:...   .||  |.:|.|:.|   :..|..|..
Mosquito   204 DRNLFSQVLTTKVYCAGSRNGTSSCNGDSGGGMFFR---MSG--YWFLRGLTSFSAVDAKQSGIC 263

  Fly   373 LFSGI--YTRVSSYMDWI-ESTIR 393
            ...|.  ||.|:.|:||: |..:|
Mosquito   264 DSHGYVGYTDVAKYLDWLREQGVR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 72/269 (27%)
Tryp_SPc 133..391 CDD:238113 74/268 (28%)
AgaP_AGAP006192XP_316257.4 Tryp_SPc 37..284 CDD:238113 73/268 (27%)
Tryp_SPc 37..280 CDD:214473 71/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.