DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP005594

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_315604.2 Gene:AgaP_AGAP005594 / 1276280 VectorBaseID:AGAP005594 Length:294 Species:Anopheles gambiae


Alignment Length:329 Identity:72/329 - (21%)
Similarity:120/329 - (36%) Gaps:94/329 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 NATSSTTTLKLLPRTTPRPPSGIDQLPEH----------PYCGSAFSFRLVGGHNTGLFEFPWTT 147
            |.:::...:|:.|.:        |:.||.          ||..||..:.   |:|....:||:..
Mosquito    19 NTSAALDVIKVNPMS--------DETPEGFKTMSAGTVVPYTYSATYWY---GYNAYAGQFPYHA 72

  Fly   148 LLEYETVSGGKDYACGASFIAQRWLLTAAHCIH-------------TMGR--NLTAAILGEWNRD 197
            .:.:.|  ....|....:.|...:::|.|...|             |:|.  |.|.    :|   
Mosquito    73 EINFYT--NNYLYKRAGALITLNYVITPASSFHHYFIHGDMLYGYITLGSVFNSTT----QW--- 128

  Fly   198 TDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLP 262
                 |..:|........|         |...|:..:|.| ||::||.||.  :|.:.::|:.||
Mosquito   129 -----EQTINYTESSIVMH---------PFFHYTNEDYYN-IAIIRLDRPA--IQTRYVKPIRLP 176

  Fly   263 PQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAM-LHIQPQDQCQEAFYKDTKITLADSQMCA 326
                :.::.....|.:.:..|.|:..|.|.::...: |.|     |::..   |..|..|...|.
Mosquito   177 ----KLSDTRTYLAMEGTSCGTTKEEGLSYLRNPLLSLSI-----CRQQL---TSYTFHDQHYCT 229

  Fly   327 GGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYT------RVSSYM 385
            ....|...|:...|..||||.....     .|.|||.:        ||...|:      |:|::.
Mosquito   230 DVYRGGSFCNRQCGSSLTVEDENGP-----VLIGVVDL--------LFQCSYSYPVRYVRLSAFR 281

  Fly   386 DWIE 389
            :||:
Mosquito   282 EWIQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 60/278 (22%)
Tryp_SPc 133..391 CDD:238113 62/279 (22%)
AgaP_AGAP005594XP_315604.2 Tryp_SPc 60..285 CDD:304450 61/275 (22%)
Tryp_SPc 60..284 CDD:214473 60/274 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.