DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP005591

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_315601.4 Gene:AgaP_AGAP005591 / 1276277 VectorBaseID:AGAP005591 Length:273 Species:Anopheles gambiae


Alignment Length:259 Identity:59/259 - (22%)
Similarity:100/259 - (38%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 EFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILG-------EWNRDTD 199
            :||:...|.::|.|..|.|.|..|.|...::||.|.|::........||||       ||.:   
Mosquito    49 QFPYHAALRFKTKSSTKVYTCAGSLITPVYILTTAACVNHNSVEYAFAILGSLFNGNTEWEQ--- 110

  Fly   200 PDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQ 264
                            ||.:|::.|..|.. |.:...||||.:.:..|..  ..:.::|:.||  
Mosquito   111 ----------------HINITMNGIRIHPP-SSMYGHNDIATIHMDHPAT--LNEYVQPIRLP-- 154

  Fly   265 RGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQ----DQCQEAFYKDTKITLADSQMC 325
                      ..:|...:...|.:.:|.:....:.:::.|    ..|.||.  .....::...:|
Mosquito   155 ----------RLSDTRTYEMMEGTATSALNGDGLRYLRNQVMSNADCHEAI--QPLYNISSQHIC 207

  Fly   326 AGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIE 389
            ....||...|...:|..||||  ..:|...|.:..::.:...|     :...:.|||.:.:|||
Mosquito   208 TDTYIGGSLCGRTTGSALTVE--DENGRMLVGVGNLIVLCDLH-----YPIRHIRVSYFREWIE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 56/256 (22%)
Tryp_SPc 133..391 CDD:238113 59/259 (23%)
AgaP_AGAP005591XP_315601.4 Tryp_SPc 42..264 CDD:238113 57/257 (22%)
Tryp_SPc 42..263 CDD:214473 56/256 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.