DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP004900

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_314989.4 Gene:AgaP_AGAP004900 / 1275705 VectorBaseID:AGAP004900 Length:265 Species:Anopheles gambiae


Alignment Length:282 Identity:77/282 - (27%)
Similarity:123/282 - (43%) Gaps:59/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 HPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIH----- 180
            |...|.....::|.|.:..:..:|:...|  ...|||  ::||.|.:..||:||||||:.     
Mosquito    20 HALSGPIDQSKIVNGTDAAIENYPFVVSL--RGASGG--HSCGGSILNDRWILTAAHCVDYTTPL 80

  Fly   181 ----TMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL-NYRNDIA 240
                .:||       .:.:|..|...                ..|:.::.|..|:.. :|.:|||
Mosquito    81 YQTIQVGR-------ADISRTEDESV----------------YAIEDVVIHPGYNPADSYIDDIA 122

  Fly   241 LLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK-QKAMLHIQPQ 304
            ||:|.:|:  :....::||.| |:|....:....:...:.|||:..|.|..:.. |:...:..|.
Mosquito   123 LLKLRKPL--VFTDQVQPVRL-PKRFFEIDVQESNLVTLVGWGRNASDGPVQTTLQEIDYYAVPN 184

  Fly   305 DQCQEAFYKDTKITLADSQMCA---GGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGR 366
            |:|.......    :..:|:||   ||  |...|||||||||..:.         :..|:||...
Mosquito   185 DECNRIHSNH----IYPTQICAAEPGG--GKGQCSGDSGGPLIYKE---------FQVGIVSWSI 234

  Fly   367 KHCGTALFSGIYTRVSSYMDWI 388
            |.|..|.:.|:.|:||.|:|:|
Mosquito   235 KPCAIAPYPGVLTKVSYYVDFI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 74/270 (27%)
Tryp_SPc 133..391 CDD:238113 75/270 (28%)
AgaP_AGAP004900XP_314989.4 Tryp_SPc 30..256 CDD:214473 74/270 (27%)
Tryp_SPc 31..259 CDD:238113 75/271 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.