DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:271 Identity:81/271 - (29%)
Similarity:115/271 - (42%) Gaps:77/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPP 215
            :...:|...:.||.|.|..|.:||||||                       ..|| :||   ||.
Mosquito     6 WRQTNGSISFDCGGSLITPRHVLTAAHC-----------------------ALND-DGV---APQ 43

  Fly   216 HIRVTIDRIL-----PHAQYS------------ELNYR---NDIALLRLSRPVNWLQMQNLEPVC 260
            .:|:.:..|.     |..|::            |..:|   :||.|:.|.|||.....  :.|.|
Mosquito    44 VVRLGVIDITAGLYDPQNQFAQEYGISSFRRHPEHEFRAEYHDIGLVTLDRPVTLTDA--VVPAC 106

  Fly   261 L------PPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYKDTKIT 318
            |      |.:|           .:..|:|:|...|. :.|..|..|.......|.. ||..::..
Mosquito   107 LWTGAQVPLRR-----------LEAVGFGQTSFGGERTPILLKVQLSPVDNSACGR-FYPPSRRR 159

  Fly   319 ---LADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYV-YLAGVVSIGRKHCGTALFSGIYT 379
               |.|.||||..| .:|:|.|||||||  :....:.||.: ::.|:.|.|| .||||. ..:||
Mosquito   160 RQGLIDQQMCASDE-RMDTCHGDSGGPL--QLKLMANNRLIPFVVGITSFGR-FCGTAT-PAVYT 219

  Fly   380 RVSSYMDWIES 390
            |||||:||:::
Mosquito   220 RVSSYVDWLQT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 80/267 (30%)
Tryp_SPc 133..391 CDD:238113 81/271 (30%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 81/268 (30%)
Tryp_SPc 1..227 CDD:214473 79/266 (30%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.