DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP004859

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_314332.2 Gene:AgaP_AGAP004859 / 1275102 VectorBaseID:AGAP004859 Length:264 Species:Anopheles gambiae


Alignment Length:262 Identity:65/262 - (24%)
Similarity:107/262 - (40%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 HNTGLF-EFPWTT---LLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNR 196
            |..|:| :.|.|:   ||......|.:::.||.|:|.|..:|..|||:  .|:|..|.....:..
Mosquito    19 HVQGIFSQNPQTSHIVLLGSTRSDGTREFRCGGSYIGQNIVLAGAHCV--TGKNQPALDTVRFGS 81

  Fly   197 DTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVC- 260
            .||    |.:         |.|: ::..|.:....:..|.| :|:..|....:.:.....:|.| 
Mosquito    82 GTD----NVM---------HFRI-VNHTLHYRYKPQFEYHN-MAVYYLDARPDLVNAGRFKPACI 131

  Fly   261 LPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMC 325
            |.|...:...|:.|.:          |:|.....|...|.:...::|.|.:....|:... ..:|
Mosquito   132 LKPHMKQGIVQMVGDS----------SNGRGLALQSTSLDVVASEKCHEYYNPIPKLRFG-VLLC 185

  Fly   326 AGGEIGVDS--CSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            ....:..|:  ||.....||.:..| .:|....:|.|..||| |.||.. ...::||..||.:|:
Mosquito   186 CFCAMNSDTTECSNMHSSPLQLVIN-RNGKSVPFLIGHKSIG-KACGVK-SPAVFTRYGSYYEWL 247

  Fly   389 ES 390
            |:
Mosquito   248 ET 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 63/258 (24%)
Tryp_SPc 133..391 CDD:238113 65/262 (25%)
AgaP_AGAP004859XP_314332.2 Trypsin 41..247 CDD:278516 56/236 (24%)
Tryp_SPc 43..250 CDD:304450 58/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.