DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP005194

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_314093.2 Gene:AgaP_AGAP005194 / 1274900 VectorBaseID:AGAP005194 Length:272 Species:Anopheles gambiae


Alignment Length:299 Identity:77/299 - (25%)
Similarity:129/299 - (43%) Gaps:70/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 EHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTM-- 182
            :||....|.:: :|.|.:......|:...|:.:..|     .|..|.:..||:|||.||:..:  
Mosquito    23 DHPISPFAANY-IVDGSDAEENAAPYQVSLQIDGNS-----TCSGSIVGDRWILTAEHCVPLLQF 81

  Fly   183 ---GRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSEL--------NYR 236
               ..|.|..:.|          .|||   ::...|:.   |||...:...|.:        :..
Mosquito    82 FSERSNNTRVVAG----------TNDL---KKGGTPYF---IDRFFNYDNCSTMLVHTFMFNSTP 130

  Fly   237 NDIALLRLSRPVNWLQ-MQNLEPVCLPPQRGRYANQLA--GSAADVSGWGKTESSGSSKIKQKAM 298
            |||||:||:.|:.:.| ::.:|          :..:..  .:...::|||:.. :|:|..|.:.:
Mosquito   131 NDIALIRLTTPLKFNQRVKKIE----------FTTETVPENATLTLTGWGQMR-NGTSPAKLQTI 184

  Fly   299 ----LHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLA 359
                :.|   |.|: |.|.:|  .|.|..:|:..:.|..:|.||||||:|.:..         |.
Mosquito   185 NAPSIRI---DHCR-AIYNET--YLNDGTICSLSKRGEGACMGDSGGPVTWKGK---------LV 234

  Fly   360 GVV-SIGRKHCGTALFSGIYTRVSSYMDWIESTIRANRI 397
            |:. ::..|.||.. |..|:|.|:.|..||:.||..|.:
Mosquito   235 GIFKAVHNKGCGEG-FPDIHTSVAYYYKWIKDTIANNSV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 69/277 (25%)
Tryp_SPc 133..391 CDD:238113 71/278 (26%)
AgaP_AGAP005194XP_314093.2 Tryp_SPc 34..266 CDD:238113 71/279 (25%)
Tryp_SPc 34..263 CDD:214473 69/276 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.