DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP004570

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_313874.5 Gene:AgaP_AGAP004570 / 1274709 VectorBaseID:AGAP004570 Length:259 Species:Anopheles gambiae


Alignment Length:274 Identity:96/274 - (35%)
Similarity:146/274 - (53%) Gaps:38/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSA-FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLT 187
            ||:| ...|:|||..||:.::||...|.|:     ..:.||||.:.:.::||||||:..:.||..
Mosquito    13 CGAANQEIRIVGGRPTGVNQYPWLARLVYD-----GQFHCGASLLTKDYVLTAAHCVRRLKRNKI 72

  Fly   188 AAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQ 252
            ..|||::::....:            .|.|...:..|:.|..:.:.:|.:|||||:|.:||.:  
Mosquito    73 RVILGDYDQFVASE------------TPAIMRAVTAIIRHRSFDQNSYNHDIALLKLRKPVEF-- 123

  Fly   253 MQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYKDTK 316
            .:.:.|||||.:|...|.||    ..|.|||:|...|: ..:.|...:.|...|||:...|:.::
Mosquito   124 TKTIRPVCLPKERSEPAGQL----GTVVGWGRTSEGGTLPALVQHVDVPILTLDQCRSMKYRASR 184

  Fly   317 ITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRV 381
            ||   |.|...|:...|||.|||||||.|.    :|::: .:.|:||.| ..||.|.:.|:||||
Mosquito   185 IT---SNMLCAGKGKQDSCQGDSGGPLLVR----NGDKH-EIVGIVSWG-VGCGRAGYPGVYTRV 240

  Fly   382 SSYMDWIESTIRAN 395
            :.|:.|    :|||
Mosquito   241 ARYLPW----LRAN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 89/257 (35%)
Tryp_SPc 133..391 CDD:238113 89/258 (34%)
AgaP_AGAP004570XP_313874.5 Tryp_SPc 21..246 CDD:214473 89/256 (35%)
Tryp_SPc 22..250 CDD:238113 90/263 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.