DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP004566

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_313869.5 Gene:AgaP_AGAP004566 / 1274708 VectorBaseID:AGAP004566 Length:327 Species:Anopheles gambiae


Alignment Length:320 Identity:102/320 - (31%)
Similarity:151/320 - (47%) Gaps:64/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PRETNIIPP-LAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHN 137
            |...|:.|| ..|....|.||            |.|                      |:|||..
Mosquito    58 PAPENLTPPDSCPMCKCGRTN------------RLT----------------------RIVGGQE 88

  Fly   138 TGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDC 202
            |.:.::||..:|:|   ||  .:.||.|.|:.|.:||||||:|...||..:.:|.|.:|.:..:.
Mosquito    89 TQVNQYPWMAMLQY---SG--TFYCGGSLISDRHVLTAAHCVHGFNRNKISVVLMEHDRVSTSES 148

  Fly   203 ENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGR 267
            ...::.|.            |::.|..|:..||.:|||:|||: .|..:: ..|.|||||..:  
Mosquito   149 MTMVSKVL------------RVIEHNGYNSNNYNSDIAILRLA-TVMTIE-DKLRPVCLPTPK-- 197

  Fly   268 YANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIG 331
              ....|....|:|||.|..:|: |...|:..:.|.....|::..|..::||  |:.:|||.:.|
Mosquito   198 --KPFTGYDGIVTGWGATSENGAISTNLQEVTVPIMSNADCRKTGYGASRIT--DNMLCAGYDEG 258

  Fly   332 -VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIES 390
             .|||.|||||||.|....::.|.: .:||:||.| :.|....:.|:||||:.:..||.|
Mosquito   259 KKDSCQGDSGGPLHVIKQNSTDNVH-QIAGIVSWG-EGCAKPNYPGVYTRVNRFGTWIRS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 102/320 (32%)
Tryp_SPc 131..388 CDD:214473 89/258 (34%)
Tryp_SPc 133..391 CDD:238113 91/260 (35%)
AgaP_AGAP004566XP_313869.5 Tryp_SPc 82..314 CDD:214473 89/258 (34%)
Tryp_SPc 83..317 CDD:238113 91/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.