DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:274 Identity:98/274 - (35%)
Similarity:130/274 - (47%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSA--FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNL 186
            |||.  .:.|:|||.......|.|...|.|:     ..:.||.|.::.|:::|||||.....|.|
Mosquito   101 CGSVEPINERIVGGIPVEDNSFSWMAALYYD-----NKFCCGGSLLSDRYVITAAHCTTKPDRGL 160

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
            .....|             :|...:.....|..::.|||.: .|:..|..||||||.|:.||  .
Mosquito   161 FRVQFG-------------INDRSKPIATSIERSVKRILTN-WYNAFNNNNDIALLELTYPV--A 209

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQCQEAFYKDT 315
            ....:.|:|||.....|    .||...|:|||:|::.|. |....:..:.|....:|:.|.|...
Mosquito   210 ISDRVMPICLPQATEMY----EGSRGIVTGWGRTKAGGGLSGTLMQTEVPILTNRECRRAGYWAF 270

  Fly   316 KITLADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYT 379
            :||  :..:|||. |.|.|||.|||||||.| .||.| |.| .|.||||.||. |....|.|:|.
Mosquito   271 QIT--NKMLCAGYLEGGKDSCQGDSGGPLQV-LNTKS-NHY-ELVGVVSWGRA-CAQKNFPGVYA 329

  Fly   380 RVSSYMDWIESTIR 393
            |||.|:.||...|:
Mosquito   330 RVSQYLYWINRNIK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 92/258 (36%)
Tryp_SPc 133..391 CDD:238113 93/259 (36%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 92/258 (36%)
Tryp_SPc 111..341 CDD:238113 93/260 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.