DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CLIPA15

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_312096.5 Gene:CLIPA15 / 1273144 VectorBaseID:AGAP002815 Length:867 Species:Anopheles gambiae


Alignment Length:307 Identity:94/307 - (30%)
Similarity:136/307 - (44%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DQLPE----HP----------YCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASF 166
            |.:||    ||          |.......|:|||.:....|:.|...|    ::....|.|||:.
Mosquito   593 DTVPEDLLHHPSVKENATLAKYWSHHRKGRVVGGEDGENGEWCWQVAL----INSLNQYLCGAAL 653

  Fly   167 IAQRWLLTAAHCIHTMGRNLTAAI--LGEWNRDTDPDCENDLNGVRECAPP---HIRVTIDRILP 226
            |..:|:||||||:..:.|:..|..  :|::          ||  .|:...|   .:||....|  
Mosquito   654 IGTQWVLTAAHCVTNIVRSGDAIYVRVGDY----------DL--TRKYGSPGAQTLRVATTYI-- 704

  Fly   227 HAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLP--PQRGRYANQLAGSAADVSGWGKTESSG 289
            |..::.....||||||:|..     |.:..:.|||.  |.||  .:..||....|:|:|....:|
Mosquito   705 HHNHNSQTLDNDIALLKLHG-----QAELRDGVCLVCLPARG--VSHAAGKRCTVTGYGYMGEAG 762

  Fly   290 SSKIK-QKAMLHIQPQDQCQEAFYKDTKIT-----LADSQMCAGGEIGVDSCSGDSGGPLTVEAN 348
            ...:: ::|.:.|....:|   ..|...:|     |..|..|||||.|.|:|.||.||||..:  
Mosquito   763 PIPLRVREAEIPIVSDAEC---IRKVNAVTEKIFILPASSFCAGGEEGNDACQGDGGGPLVCQ-- 822

  Fly   349 TASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
               .:.:..|||:||.| ..||.....|:|.:|||::.||...|..|
Mosquito   823 ---DDGFFELAGLVSWG-FGCGRVDVPGVYVKVSSFIGWINQIISVN 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 84/269 (31%)
Tryp_SPc 133..391 CDD:238113 85/270 (31%)
CLIPA15XP_312096.5 Tryp_SPc 622..858 CDD:214473 84/269 (31%)
Tryp_SPc 623..861 CDD:238113 85/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.