DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP010415

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_311533.3 Gene:AgaP_AGAP010415 / 1272633 VectorBaseID:AGAP010415 Length:304 Species:Anopheles gambiae


Alignment Length:340 Identity:76/340 - (22%)
Similarity:132/340 - (38%) Gaps:71/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LTLLGAEAQQFGKAIMHFGNCNSVEFGRGTCIEKKDCD---FYAVDKLMELASKQQCFSRQRPDL 70
            ||.|.::...||:.:.....|...:.|.|.|  ..|..   |:.......|..... ||......
Mosquito     7 LTCLASDRAFFGRLLYSKAFCAGYKNGTGVC--NGDSGGGMFFQFQNRWYLKGVVS-FSNTIDAT 68

  Fly    71 VCCPRETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQ-LPEHPYCGSAFSFRLVG 134
            ..|..:..|          |.|:|:.   .:..|...||.  ||||. :..||      :.||:.
Mosquito    69 GVCNLKQYI----------GFTDASQ---YIDWLYENTPN--SGIDDPILGHP------NIRLIN 112

  Fly   135 ----GHNTGLFEF-----------PWTTLLEYETVSGGKDYA-CGASFIAQRWLLTAAHCIHTMG 183
                |.|..::||           ||...|.:..|.  .:|. |....:.:.::|| .:|:..  
Mosquito   113 QGNCGRNEHIYEFGEDRKPIFKQYPWMVTLRHPFVD--SEYVPCNGVLLNRNYVLT-TNCVDL-- 172

  Fly   184 RNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRND-IALLRLSRP 247
            ::..:..||:::.....|| ..::|..:|......|::.::          :|.| :.|.||:.|
Mosquito   173 QDEISVTLGDYDTSKTKDC-GTIDGREQCVSGVQTVSVGQL----------FRKDNLVLARLTVP 226

  Fly   248 VNWLQMQNLEPVCL---PPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQE 309
            ....:..::|.:||   |.||.|..|:..     ::||  .||...::|.|:|:|.....::|:.
Mosquito   227 AVIGRRDHIESICLPVTPQQRERLYNRYI-----MTGW--KESGSDARILQRALLEAIDLNKCRA 284

  Fly   310 AFYKDTKITLADSQM 324
            .|...:..:.|..|:
Mosquito   285 EFQASSYASEASKQI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 9/47 (19%)
Tryp_SPc 131..388 CDD:214473 48/214 (22%)
Tryp_SPc 133..391 CDD:238113 46/212 (22%)
AgaP_AGAP010415XP_311533.3 Tryp_SPc <1..92 CDD:304450 20/100 (20%)
Tryp_SPc 135..>294 CDD:304450 40/181 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.