DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP010662

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_311382.4 Gene:AgaP_AGAP010662 / 1272470 VectorBaseID:AGAP010662 Length:584 Species:Anopheles gambiae


Alignment Length:299 Identity:84/299 - (28%)
Similarity:126/299 - (42%) Gaps:52/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DQLPEHPY----CGSAFSFR---LVGGHNTGLFEFPWTTLLEYETV-SGGKDYACGASFIAQRWL 172
            |:|..:.|    ||.....|   :.||::|...::||...|.:..: |.|.:||||.|.:.:..:
Mosquito    17 DELHINDYNDNECGERMVKRKGLVKGGYSTQPGDWPWHAALYHRGINSAGFEYACGGSIVHRYLV 81

  Fly   173 LTAAHCI--HTMGRNLTA----AILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYS 231
            ||||||:  .|..|.:.|    ..||.:|.         :|...|.|.   ...:...:.|..|.
Mosquito    82 LTAAHCVTLATSRRKIPAENMQLRLGRFNL---------MNNEEEYAE---EFDVIETIMHEGYR 134

  Fly   232 ELNYRNDIALLRLSRPVNWLQMQNLEPVCL-PPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQ 295
            ...:.||||:||:..|:  :....::|||| ....|............|.|||.:|.:.......
Mosquito   135 PTTFENDIAILRVEIPI--IFNDYIQPVCLWKRDDGVVLPWFYNQPGTVVGWGLSEDNMIGTTLN 197

  Fly   296 KAMLHIQPQDQC---QEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVY 357
            :|.:.:.....|   ..||:..   .|.....|||.:.|...|:|||||.:..:..    ||: |
Mosquito   198 EARMPVVDSWTCLASDRAFFGK---FLQSKAFCAGYKNGTGVCNGDSGGGMFFQFQ----NRW-Y 254

  Fly   358 LAGVVSIGRKHCGTALFSGI--------YTRVSSYMDWI 388
            |.||||..    .|..:||:        :|..|.|:||:
Mosquito   255 LKGVVSFS----NTNDYSGVCNLKQYIGFTDASQYIDWV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/278 (28%)
Tryp_SPc 133..391 CDD:238113 78/275 (28%)
AgaP_AGAP010662XP_311382.4 Tryp_SPc 42..292 CDD:238113 78/274 (28%)
Tryp_SPc 42..289 CDD:214473 77/272 (28%)
Tryp_SPc 334..578 CDD:214473
Tryp_SPc 334..578 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.