DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CLIPA9

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_309727.4 Gene:CLIPA9 / 1270989 VectorBaseID:AGAP010968 Length:361 Species:Anopheles gambiae


Alignment Length:282 Identity:86/282 - (30%)
Similarity:127/282 - (45%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSFRLVGGHNTGLF-----EFPWTTLLEYETVSGGK---DYACGASFIAQRWLLTAAHCIH 180
            |||..:|.||....:.|.     |||||..:...:.|..:   ....|.|.|..:::|||||.:.
Mosquito    94 CGSPVTFPLVYNVESNLTYANYGEFPWTVAIFNISFSANEMKLTLVGGGSLIHPKFVLTAAHTLK 158

  Fly   181 TMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSE-LNYRNDIALLRL 244
            ...|.:  |..|||:.::|.:..           |...:.|:..:.|..|.: ....|||||..|
Mosquito   159 KPDRYV--ARFGEWSINSDAEIY-----------PSQDIGIEEHIIHPSYRDSCLLENDIALAVL 210

  Fly   245 SRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWG-KTESSGSSKIKQKAMLHIQPQDQCQ 308
            .|  |.:..:::.|:|||..    .:...|.....:||| ...:...:.|.::..|.:.|:|:||
Mosquito   211 KR--NVIYTEHIRPICLPSP----TDVFDGQRCIATGWGLDVRTQQPAPIMKRIELPVVPRDRCQ 269

  Fly   309 EAFYK---DTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCG 370
            ..:.:   |....|..|.||||||:|.|:|..|.|.||..:....|   || :||:.|.| ..||
Mosquito   270 LLYRRAEVDYSFKLHRSMMCAGGEVGEDTCDQDGGTPLACKKEDGS---YV-VAGITSWG-LDCG 329

  Fly   371 TALFSGIYTRVSSYMDWIESTI 392
            .....|||..|:.:..||..||
Mosquito   330 RVDAPGIYVDVAKFACWINDTI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/269 (29%)
Tryp_SPc 133..391 CDD:238113 79/270 (29%)
CLIPA9XP_309727.4 Tryp_SPc 113..350 CDD:238113 77/260 (30%)
Tryp_SPc 113..347 CDD:214473 75/257 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.