DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CLIPA10

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_308802.3 Gene:CLIPA10 / 1270130 VectorBaseID:AGAP006954 Length:1130 Species:Anopheles gambiae


Alignment Length:344 Identity:101/344 - (29%)
Similarity:142/344 - (41%) Gaps:75/344 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KQQCFSRQRPDLVCCPRETNIIPPLAPRISN-GTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHP 122
            :|||..||    ||| |:.....|.:..:.. |..||......:|        .|..:|      
Mosquito   841 QQQCSGRQ----VCC-RKPVYRNPASQNLGKCGVRNAQGINGRIK--------NPVYVD------ 886

  Fly   123 YCGSAFSFRLVGGHNTGLFEFPWTTLL----EYETVSGGKDYACGASFIAQRWLLTAAHCIHTMG 183
                       |....|  |:||...:    ..|:|     |.||.:.|...:::|||||:.|..
Mosquito   887 -----------GDSEFG--EYPWQVAILKKDPKESV-----YVCGGTLIDNLYIITAAHCVKTYN 933

  Fly   184 RNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPV 248
            .......||||  |.:.|.|         ..|:|...|..:..|.:|......||:|:|::.|||
Mosquito   934 GFDLRVRLGEW--DVNHDVE---------FYPYIERDIISVQVHPEYYAGTLDNDLAILKMDRPV 987

  Fly   249 NWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSK---IKQKAMLHIQPQDQCQEA 310
            :.....::.|.|||.:.    ...:|.....:||||.......|   |.::..:.|....|||..
Mosquito   988 DLTSAPHIAPACLPDKH----TDFSGQRCWTTGWGKDAFGDYGKYQNILKEVDVPIVNHYQCQNQ 1048

  Fly   311 FYKDTKI----TLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVS--IGRKHC 369
            . :.|::    .|....:|||||.|.|:|.||.||||..|.|..     ..:.||||  ||   |
Mosquito  1049 L-RQTRLGYTYNLNQGFICAGGEEGKDACKGDGGGPLVCERNGV-----WQVVGVVSWGIG---C 1104

  Fly   370 GTALFSGIYTRVSSYMDWI 388
            |.|...|:|.:|:.|:|||
Mosquito  1105 GQANVPGVYVKVAHYLDWI 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 7/14 (50%)
Tryp_SPc 131..388 CDD:214473 83/269 (31%)
Tryp_SPc 133..391 CDD:238113 85/269 (32%)
CLIPA10XP_308802.3 Tryp_SPc 888..1126 CDD:238113 84/267 (31%)
Tryp_SPc 888..1123 CDD:214473 82/265 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.