DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP007252

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_308550.4 Gene:AgaP_AGAP007252 / 1269896 VectorBaseID:AGAP007252 Length:305 Species:Anopheles gambiae


Alignment Length:307 Identity:82/307 - (26%)
Similarity:126/307 - (41%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 KLLPRTTPRPPSGIDQLPE-----------HPYCGSAFSFRLVGGH--NTGLFEFPWTTLLEYET 153
            |:.|.|  |.|....:||:           :...|:..:.|:|.|:  ..|.|.:....|..:.|
Mosquito    25 KVRPMT--RMPQYWRRLPKDLLKQYLTEVRNMPAGARDNARIVNGYVAQPGQFPYQVAILSTFPT 87

  Fly   154 VSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIR 218
            .||    .||.|.:...::||||||:......|  .|.|..:|..:             .|...|
Mosquito    88 GSG----LCGGSVLTANYVLTAAHCVDVSNGGL--VIYGAQDRTVN-------------EPSQQR 133

  Fly   219 VTIDR--ILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSG 281
            :..::  :..|..::....|.|||.:|:..||.:  ...::||.| |:.....|..||....|||
Mosquito   134 IAFEQSGVRLHPNWNPALIRYDIATIRVVSPVTF--SDRIQPVTL-PRLSDVGNDFAGLIGTVSG 195

  Fly   282 WGKTESS--GSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLT 344
            :|:...|  .:|.|.:.....||....|...|    ...:....:|..|:.|..:|.||||||||
Mosquito   196 FGRFSDSIQEASAILRYVNNPIQTNLACSVRF----PGVVQPENICLSGDSGRGACQGDSGGPLT 256

  Fly   345 V--EANTASGNRYVYLAGVVSIGRKHCGTAL-FSGIYTRVSSYMDWI 388
            :  :..|..       .||||.|.. .|..| :..::.|.:|::.||
Mosquito   257 IVRDGTTVQ-------LGVVSFGLA-LGCELNWPSVFARTTSFLAWI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 72/265 (27%)
Tryp_SPc 133..391 CDD:238113 73/265 (28%)
AgaP_AGAP007252XP_308550.4 Tryp_SPc 63..295 CDD:214473 72/265 (27%)
Tryp_SPc 64..295 CDD:238113 71/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.