DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP010635

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_307830.4 Gene:AgaP_AGAP010635 / 1269219 VectorBaseID:AGAP010635 Length:569 Species:Anopheles gambiae


Alignment Length:305 Identity:86/305 - (28%)
Similarity:131/305 - (42%) Gaps:57/305 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DQLPEHPY----CGSAFSFRLV-------GGHNTGLFEFPWTTLLEYETVSGGKD--YACGASFI 167
            |:|..:.|    ||.    |||       ||::|...::||...| |......:|  ||||::.:
Mosquito    25 DELEIYDYNDNECGE----RLVKRQELVKGGYSTHPGDWPWHAAL-YHRGFNSRDFEYACGSTIV 84

  Fly   168 AQRWLLTAAHCI--HTMGRNLTA----AILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILP 226
            .:..::|||||:  .|..|.:.:    ..||.:|.         :|...|.|...  ..||.|: 
Mosquito    85 HRYLVITAAHCVTFATSRRKIPSDNMQLRLGRFNL---------MNNEEEYAEEF--SVIDTIV- 137

  Fly   227 HAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCL-PPQRGRYANQLAGSAADVSGWGKTESSGS 290
            |..|......||||:||:..|:  :....::|||| ....|.....:......|.|||.:|::..
Mosquito   138 HEGYRPTTLENDIAILRVEIPI--IFNDYIQPVCLWKRDDGFDLPNVYNQPGTVVGWGLSENNRI 200

  Fly   291 SKIKQKAMLHIQPQDQC---QEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASG 352
            .....:|.:.:.....|   ..||:..   .|.....|||.:.|...|:|||||.:..:..    
Mosquito   201 GTTLNEAQMPVVNSWTCLASDRAFFGR---FLQSKAFCAGYKNGTGVCNGDSGGGMFFQFQ---- 258

  Fly   353 NRYVYLAGVVSIGRKH-----CGTALFSGIYTRVSSYMDWI-EST 391
            ||: ||.|:||....:     |....:.| :|..|.|:||: |:|
Mosquito   259 NRW-YLKGIVSFSSVNDYSGWCNLRQYIG-FTDASQYIDWVYENT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/280 (28%)
Tryp_SPc 133..391 CDD:238113 78/282 (28%)
AgaP_AGAP010635XP_307830.4 Tryp_SPc 50..300 CDD:238113 76/273 (28%)
Tryp_SPc 50..297 CDD:214473 75/270 (28%)
Tryp_SPc 342..563 CDD:214473
Tryp_SPc 342..563 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.