DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and AgaP_AGAP012614

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_306194.4 Gene:AgaP_AGAP012614 / 1267637 VectorBaseID:AGAP012614 Length:393 Species:Anopheles gambiae


Alignment Length:180 Identity:62/180 - (34%)
Similarity:98/180 - (54%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEY 151
            |.:.|.::|..|::                 |||.|:||.....|::.|.:|.:.|||||.|:|:
Mosquito   230 IVDWTLSSTQKTSS-----------------LPESPHCGIQLGDRVLSGQSTQIDEFPWTALIEF 277

  Fly   152 ETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRN--LTAAILGEWNRDTDPDCENDLNGVRECAP 214
            :...|...:.||.|.|..|:::||||||.::.|:  :....||||:..|..||:|:.     |:.
Mosquito   278 QKPDGSFGFHCGGSLINDRYIVTAAHCIKSIPRDWKVQRVRLGEWDLATANDCQNEF-----CSD 337

  Fly   215 PHIRVTIDRILPHAQY--SELNYRNDIALLRLSRPVNWLQMQNLEPVCLP 262
            ..|.:.|::|:.|..|  .:.:..|||||:|.:||||:  .|.:.|:|||
Mosquito   338 APIDLDIEQIVVHTGYDTKDKSNANDIALIRFTRPVNY--SQTVRPICLP 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 52/136 (38%)
Tryp_SPc 133..391 CDD:238113 51/134 (38%)
AgaP_AGAP012614XP_306194.4 Tryp_SPc <1..149 CDD:214473
Tryp_SPc <1..149 CDD:238113
Tryp_SPc 261..>389 CDD:304450 51/132 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.