DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Ctrl

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:313 Identity:98/313 - (31%)
Similarity:148/313 - (47%) Gaps:66/313 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 SSTTTLKLL--------PRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYE 152
            |.|.:|.||        |..||               ..:::.|:|.|.|.....:||...|:..
  Rat     5 SLTLSLVLLGSSWGCGVPAITP---------------ALSYNQRIVNGENAVPGSWPWQVSLQDN 54

  Fly   153 TVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHI 217
            |   |..: ||.|.||..|::|||||..|.||:.  .||||::|.::             |.|..
  Rat    55 T---GFHF-CGGSLIAPNWVVTAAHCKVTPGRHF--VILGEYDRSSN-------------AEPIQ 100

  Fly   218 RVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQL--AGSAADVS 280
            .::|.:.:.|..::.....||:.||:|:.|..:  ...:.||||..     :|:.  ||.....:
  Rat   101 VLSISKAITHPSWNPNTMNNDLTLLKLASPARY--TAQVSPVCLAS-----SNEALPAGLTCVTT 158

  Fly   281 GWGKTESSGS---SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIGVDSCSGDSGGP 342
            |||:....|:   ::: |:.:|.:...:||::  |..::||  ||.:|||| .|..||.||||||
  Rat   159 GWGRISGVGNVTPARL-QQVVLPLVTVNQCRQ--YWGSRIT--DSMICAGG-AGASSCQGDSGGP 217

  Fly   343 LTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            |..:    .||.:| |.|:||.|.::|.... ..:|||||.:..||...|..|
  Rat   218 LVCQ----KGNTWV-LIGIVSWGTENCNVQA-PAMYTRVSKFNTWINQVIAYN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 86/261 (33%)
Tryp_SPc 133..391 CDD:238113 87/262 (33%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 86/261 (33%)
Tryp_SPc 34..260 CDD:238113 87/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.