DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and LOC116407662

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_031749278.1 Gene:LOC116407662 / 116407662 -ID:- Length:329 Species:Xenopus tropicalis


Alignment Length:270 Identity:84/270 - (31%)
Similarity:133/270 - (49%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195
            |:|||.::...:.||..::.:.:     ...||.:.|:.|::||||.|:.:........|||.:|
 Frog    40 RIVGGQDSKKGQHPWQAIVWHPS-----KVRCGGTLISSRYVLTAAQCLESENDTSVIVILGAYN 99

  Fly   196 RDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVC 260
                      :.|..:   ..:.|.::||:.|.:|::.::..|||||.||..|.:...  :.|.|
 Frog   100 ----------ITGNHK---EEVSVKVNRIILHHRYNDSDFPYDIALLELSNSVPFTDF--ILPAC 149

  Fly   261 LPPQRGRYANQLAGSAADVSGWGKTESSGSSK---IKQKAMLHIQPQDQCQEAFYK----DTKIT 318
            |||....:   |.|.:..|:|||.|:...:..   |.|:|.:.:.....|:: .||    |:.||
 Frog   150 LPPFPTEF---LPGHSCLVTGWGDTDYDSTKPKPVILQEAGVRLIDLQHCRD-LYKLVTNDSIIT 210

  Fly   319 LADSQMCAGGEIGVDS-CSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVS 382
              ::..||....|..| |.||.||||...|    |.:: :|.||||.| ..||..: .|:||.|.
 Frog   211 --ENMTCAMDIHGKRSFCRGDGGGPLVCHA----GEQW-FLVGVVSFG-YGCGHGI-PGVYTSVP 266

  Fly   383 SYMDWIESTI 392
            :|:|||:..|
 Frog   267 AYVDWIKEHI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 81/264 (31%)
Tryp_SPc 133..391 CDD:238113 82/265 (31%)
LOC116407662XP_031749278.1 Tryp_SPc 41..275 CDD:238113 82/266 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.