DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and KLK11

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:308 Identity:86/308 - (27%)
Similarity:133/308 - (43%) Gaps:81/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AFSFRLVGGHNTGLFEF-------PWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHT--- 181
            |.:..||||....:..|       ||...|..:|     ...|||:.||.|||||||||:..   
Human    42 ALATGLVGGETRIIKGFECKPHSQPWQAALFEKT-----RLLCGATLIAPRWLLTAAHCLKPWVS 101

  Fly   182 ------MGRNLTAA------------ILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHA 228
                  :..:|:::            .||:.|...:..||...             |.....||.
Human   102 LTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKEEGCEQTR-------------TATESFPHP 153

  Fly   229 QYS----ELNYRNDIALLRLSRPVN--W-LQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTE 286
            .::    ..::||||.|::::.||:  | ::...|...|:          .||::..:||||.| 
Human   154 GFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCV----------TAGTSCLISGWGST- 207

  Fly   287 SSGSSKIKQK---AMLHIQPQDQCQEAFYKDTKITLADSQMCAG-GEIGVDSCSGDSGGPLTVEA 347
            ||...::...   |.:.|....:|:.|:..:    :.|:.:||. .|.|.|||.|||||||....
Human   208 SSPQLRLPHTLRCANITIIEHQKCENAYPGN----ITDTMVCASVQEGGKDSCQGDSGGPLVCNQ 268

  Fly   348 NTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIRAN 395
            :         |.|::|.|:..|......|:||:|..|:|||:.|::.|
Human   269 S---------LQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 81/295 (27%)
Tryp_SPc 133..391 CDD:238113 82/296 (28%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 77/288 (27%)
Tryp_SPc 54..303 CDD:238113 79/290 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.