DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss48

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:280 Identity:86/280 - (30%)
Similarity:128/280 - (45%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CG-SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCI-HTMGRNL 186
            || ..:|.|:|||....|..:||...|.:::.     :.||.|.|:..|::|||||| .|....|
  Rat    31 CGRPVYSGRIVGGQGAALGHWPWQVSLRFDST-----HICGGSLISNHWVMTAAHCIKKTWFSFL 90

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
            .:..||..:||.....|              ...:.||:..:::.  |...|||||:||..|.:.
  Rat    91 YSVWLGSIDRDYSSTGE--------------EYYVSRIVIPSKHH--NTDGDIALLKLSSRVTFT 139

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAAD-VSGWGKTESSGSSKIKQKAMLHIQPQDQCQEA----- 310
            .:  :.|:|||    ..:..|...|:. |:|||:.:........|:..:.|...:.|::.     
  Rat   140 SL--VLPICLP----NISKPLTVPASCWVTGWGQNQEGHYPSTLQELEVPIITGEACEQLYNPIG 198

  Fly   311 -FYKDTKITLADSQMCAGGEI--GVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTA 372
             |..|.:..:.:..:|| |||  ..|||.|||||||:...:.....     .||:|.|.: ||..
  Rat   199 FFLPDLERIIKEDMLCA-GEIQQSKDSCKGDSGGPLSCHIDGVWTQ-----IGVISWGLE-CGKN 256

  Fly   373 LFSGIYTRVSSYMDWIESTI 392
            | .|:||.|:.|..||.|.|
  Rat   257 L-PGVYTNVTYYQKWISSII 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 79/266 (30%)
Tryp_SPc 133..391 CDD:238113 80/267 (30%)
Prss48XP_017446782.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.