DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and MASP2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:288 Identity:80/288 - (27%)
Similarity:136/288 - (47%) Gaps:36/288 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GIDQLPE-HPYCG-SAFSF--RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLT 174
            |...||. .|.|| ||.:.  |:.||......:|||..|:...|.:.|       :.:...|:||
Human   423 GEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAG-------ALLYDNWVLT 480

  Fly   175 AAHCIHTMGRNLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYS-ELNYRND 238
            |||.::....:.:|             .:..:..::..:|.:.:...:.:..|..|: :..:.||
Human   481 AAHAVYEQKHDASA-------------LDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDND 532

  Fly   239 IALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQP 303
            |||::|:..|  :...|:.|:|||.:... :..........||||.|:....::......:.|..
Human   533 IALIKLNNKV--VINSNITPICLPRKEAE-SFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVD 594

  Fly   304 QDQCQEAFYKD--TKITLADSQMCAGGEI-GVDSCSGDSGGPLT-VEANTASGNRYVYLAGVVSI 364
            ..:|..|:.|.  .:.::..:.:|||.|. |.|||.|||||.|. :::.|   .|: ::.|:||.
Human   595 HQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSET---ERW-FVGGIVSW 655

  Fly   365 GRKHCGTALFSGIYTRVSSYMDWIESTI 392
            |..:||.|...|:||:|.:|:.|||:.|
Human   656 GSMNCGEAGQYGVYTKVINYIPWIENII 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 68/261 (26%)
Tryp_SPc 133..391 CDD:238113 70/262 (27%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478
Sushi 366..430 CDD:278512 3/6 (50%)
Tryp_SPc 444..679 CDD:214473 68/261 (26%)
Tryp_SPc 445..682 CDD:238113 70/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.