DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and CG42694

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:287 Identity:66/287 - (22%)
Similarity:113/287 - (39%) Gaps:70/287 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 YCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLT 187
            |||:..|.:.:    |.|.: |....|.:  :|.|....|..|.|:::::|:||.||...|:...
  Fly    26 YCGAPISNQSI----TKLRQ-PQAGWLAH--ISNGTHVLCSGSLISKQFVLSAAQCIDVHGKLFV 83

  Fly   188 AAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQ 252
            .  ||..|....               ||.....:.::|  .:|....:.||.||:||:.|::..
  Fly    84 Q--LGVSNATKS---------------PHWYTVSNVVIP--SHSGKRLQRDIGLLKLSQSVDYND 129

  Fly   253 MQNLEPVCLPPQRGRYANQLAGSAADV---------SGWGKTESSGSSKIKQKAMLHIQPQDQCQ 308
            .  :.|:|:         .|..:..|:         |.|     ...:|..|..:|....:|:| 
  Fly   130 F--VYPICI---------ALNTNTLDMVKILQNFTTSAW-----LSKNKNPQTIVLSQLSRDRC- 177

  Fly   309 EAFYKDTKITLADS----QMCAGGEIGVDSCSGDSGGPLT---VEANTASGNRYVYLAGVVSIGR 366
                   |:.|:.:    ::||......:||..|||..||   ::.:.........:.|.|: ||
  Fly   178 -------KLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVN-GR 234

  Fly   367 KHCGTALFSGIYTRVSSYMDWIESTIR 393
            ..|..   ..||..|:..:.|||:.::
  Fly   235 SWCSE---PAIYIDVAECVGWIETVVQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 59/272 (22%)
Tryp_SPc 133..391 CDD:238113 62/273 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 59/258 (23%)
Tryp_SPc 46..253 CDD:214473 56/255 (22%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.