DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and tmprss2.15

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:341 Identity:92/341 - (26%)
Similarity:139/341 - (40%) Gaps:86/341 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RETNIIPPLAPRISNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCG--SAFSFRLVGGHN 137
            :.:|:...:...::...|.|:.:..:|:.:.                  ||  :....|:|||..
 Frog   224 QSSNVTGKMYTNLNYSATCASGNMVSLRCIS------------------CGLSTKVDSRIVGGTP 270

  Fly   138 TGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDC 202
            ..:.::||.  :|...:.|...|.||.|.|...|::|||||::  |...|               
 Frog   271 ASVGDWPWQ--VELLKLVGTSIYLCGGSIITPHWIVTAAHCVY--GSTST--------------- 316

  Fly   203 ENDLNGVRECAPPHIRV---------------TIDRILPHAQYSELNYRNDIALLRLSRPVNWLQ 252
                       |...:|               |::|.|.|..||......|:|||:|:..:  :.
 Frog   317 -----------PSAFKVFAGSLTIQSYYSAGYTVERALVHPSYSSYTQIYDVALLKLTAAL--VF 368

  Fly   253 MQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLHIQPQDQC-QEAFYKDT 315
            ..||.|||||.....:|.   |....:||||.|...|| ||....|.:.|.....| |.|.|.. 
 Frog   369 TTNLRPVCLPNVGMPWAE---GQPCWISGWGTTAEGGSISKNLMAASVPIISSTTCNQAAVYGG- 429

  Fly   316 KITLADSQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGI 377
              .::.:.||||   |  |.|:|.|||||||..:.|:     ..:|.|..|.| ..|..|...|:
 Frog   430 --AISSTMMCAGYLSG--GTDTCQGDSGGPLVTKTNS-----LWWLVGDTSWG-YGCARAYKPGV 484

  Fly   378 YTRVSSYMDWIESTIR 393
            |..|:.:::||.|.::
 Frog   485 YGNVTVFIEWIYSQMQ 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 83/276 (30%)
Tryp_SPc 133..391 CDD:238113 84/277 (30%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 6/52 (12%)
Tryp_SPc 265..498 CDD:238113 84/278 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.