DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and LOC101732176

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:342 Identity:94/342 - (27%)
Similarity:132/342 - (38%) Gaps:94/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SNGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYC--GSAFSF-------------RLVGGHN 137
            |||.....|||.|.||           ...|.....|  |:..|.             |:|||..
 Frog   229 SNGYVKLKSSTVTGKL-----------YKNLQYSATCTTGTMVSLRCINCGLSTKVDNRIVGGTF 282

  Fly   138 TGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIH----------------TMGRNL 186
            ....::||.  :....:.|...|.||.|.|...|::|||||::                |:....
 Frog   283 ALAGDWPWQ--ISLMKLVGTSLYLCGGSIITPYWIVTAAHCVYGYTSSPSIFKVFAGSLTLSNYY 345

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWL 251
            :|..|                             :||:|.|..||......|||||:|...:  :
 Frog   346 SAGYL-----------------------------VDRVLIHPSYSPNTQNYDIALLKLKTAL--V 379

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQK-AMLHIQPQDQCQEA-FYKD 314
            ...||.|||||.....:|:   |....:||||.|..:||.....| |.:.|.....|..| .|..
 Frog   380 FSTNLRPVCLPNVGMPWAD---GQPCWISGWGTTSEAGSISTSLKAASVPIISSATCNLAPVYGG 441

  Fly   315 TKITLADSQMCA---GGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSG 376
               .::.:.:||   ||  |.|:|.|||||||..:.|:     ..:|.|..|.| ..|..|...|
 Frog   442 ---VISPTMICAGYLGG--GTDTCQGDSGGPLVTKTNS-----LWWLVGDTSWG-YGCARAYKPG 495

  Fly   377 IYTRVSSYMDWIESTIR 393
            :|..::.:::||.|.::
 Frog   496 VYGNITVFLEWIYSQMQ 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/277 (28%)
Tryp_SPc 133..391 CDD:238113 79/278 (28%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 13/52 (25%)
Tryp_SPc 277..510 CDD:238113 79/279 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.