DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and cela1.2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:274 Identity:78/274 - (28%)
Similarity:126/274 - (45%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 AFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAIL 191
            |...|:|||.......:||...|:|..: |...|.|..:.|...|::.||||:..: |..|.| |
Zfish    25 AIEERVVGGEIAKPHSWPWQISLQYSDL-GTYYYYCSGTLIRPGWVMVAAHCVEAL-RKWTVA-L 86

  Fly   192 GEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELN--YRNDIALLRLSRPV---NWL 251
            |:.:..|...             |...:::..:..|..::..|  :..||||||||...   :::
Zfish    87 GDHDIYTHEG-------------PEQYISVSEVFIHPNWNPNNVAFGYDIALLRLSIDATLSSYV 138

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSG--SSKIKQKAMLHIQPQDQCQEAFYKD 314
            |:..|      |..|.....  |....::|||.||:.|  |:::|| |.:.:...:.|.:..:..
Zfish   139 QVATL------PSSGEILPY--GHTCYITGWGYTETGGSLSAQLKQ-AYMPVVDYETCSQKDWWG 194

  Fly   315 TKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVS-IGRKHCGTALFSGIY 378
            :.:  .::.:||||...:.:|.||||.||    |.....:|| :.||.| :..:.|.|......:
Zfish   195 SSV--KETMICAGGTTSMSACHGDSGSPL----NCLFNGKYV-VHGVTSFVSPEGCNTYKKPTGF 252

  Fly   379 TRVSSYMDWIESTI 392
            ||||:|::||...|
Zfish   253 TRVSAYINWINQII 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 74/264 (28%)
Tryp_SPc 133..391 CDD:238113 75/265 (28%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 74/264 (28%)
Tryp_SPc 30..265 CDD:238113 75/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.