DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and ovch2

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:294 Identity:84/294 - (28%)
Similarity:129/294 - (43%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHC 178
            |:.|:|......|.........|:     :||.|.|:|     ..::.|..:.|.::|:||.|.|
 Frog   589 GVSQVPPRFISNSIAKVEEAAPHS-----WPWHTSLQY-----AGEHVCDGAIITEKWILTTASC 643

  Fly   179 IHTMGRN-LTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALL 242
            :.....| |..||.|          .:||:.:..    :.:..:.:|:||..::......||||:
 Frog   644 VFNRKLNDLWLAIPG----------IHDLSWLGH----NQKGLVKQIIPHPSFTGQTNDFDIALV 694

  Fly   243 RLSRPVNWLQMQ-NLEPVCLPPQRGRYANQLAGSAADVSGWG--KTESSGSSKIKQKAMLHIQP- 303
            .|...   ||.. ::.|:|||   |:.:...|.|...|||||  ..|:..|:|::|    |..| 
 Frog   695 ELDES---LQFNGDIFPICLP---GKNSEVAAASLCVVSGWGLRGKEAEKSTKLQQ----HEVPI 749

  Fly   304 --QDQCQEAFYKDTKITLADSQMCAG---GEIGVDSCSGDSGGPLT--VEANTASGNRYVYLAGV 361
              .|.| :|.|:.....:.|..:|||   |: |..|||..|||||.  :|..           |:
 Frog   750 FAVDAC-KALYRQHPGGITDRMLCAGIGTGQ-GNSSCSEQSGGPLVCLLEEK-----------GI 801

  Fly   362 VSI-GRKHCGTALFSGIYTRVSSYMDWIESTIRA 394
            .:| |....|.....|:||:|.|::|||:....|
 Frog   802 YAIFGLASWGINCKPGVYTKVPSFVDWIDQITSA 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/269 (29%)
Tryp_SPc 133..391 CDD:238113 79/270 (29%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113
CUB 330..436 CDD:238001
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113 79/272 (29%)
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.