DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and mst1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_004915630.2 Gene:mst1 / 100494056 XenbaseID:XB-GENE-487985 Length:736 Species:Xenopus tropicalis


Alignment Length:280 Identity:78/280 - (27%)
Similarity:128/280 - (45%) Gaps:48/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CG-----SAFSFRLVGG--HNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHT 181
            ||     |:...|:|||  .|:     |||..|.    :...::.||.|.:.:.|:::...|..:
 Frog   493 CGKRNDRSSQRTRIVGGMPGNS-----PWTVSLR----NRQGEHFCGGSLVKENWVISTRQCFSS 548

  Fly   182 MGRNLTA--AILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRL 244
            ...:|:.  |::|...::..||           .|....|.|.:|:.....|.|      .:|:|
 Frog   549 CDADLSGYQAVMGTLFKNPSPD-----------DPDRQSVPISKIVCGPSDSSL------VMLKL 596

  Fly   245 SRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQE 309
            .|||.......|  :||||:  ||....| :..:::|||.|..:|...:.:.|:.||...|:|.:
 Frog   597 ERPVTLNSRVAL--ICLPPE--RYIVPEA-TKCEIAGWGDTGGTGHDNVLKIAIFHIISNDECNK 656

  Fly   310 AFYKDTKITLADSQMCAGG-EIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTAL 373
            . |:..:..:.|::||... .:.|.:|.||.||||....:..    :| |.||: :..:.||...
 Frog   657 N-YRSQRNKVLDNEMCTKPVPVDVGACEGDYGGPLACLTHDC----WV-LEGVI-VPARGCGKKN 714

  Fly   374 FSGIYTRVSSYMDWIESTIR 393
            ...|:||||.|:|||...::
 Frog   715 QPAIFTRVSVYVDWINKVMK 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 73/261 (28%)
Tryp_SPc 133..391 CDD:238113 74/262 (28%)
mst1XP_004915630.2 PAN_AP_HGF 36..114 CDD:238532
KR 118..198 CDD:214527
KR 201..279 CDD:214527
KR 308..390 CDD:214527
KR 397..474 CDD:412161
Tryp_SPc 506..732 CDD:238113 74/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.