DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and LOC100491119

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_004916446.1 Gene:LOC100491119 / 100491119 -ID:- Length:512 Species:Xenopus tropicalis


Alignment Length:290 Identity:80/290 - (27%)
Similarity:123/290 - (42%) Gaps:78/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSAFSF--RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNL 186
            ||.|...  |:|||.::.|.::||...|.::    |: :.||.|.|:.:|:::||||.       
 Frog   265 CGQASVDIPRIVGGTDSSLGKWPWQVSLRWD----GR-HMCGGSIISSQWVMSAAHCF------- 317

  Fly   187 TAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHA---------QYSELN-YRN---- 237
                              .|||.         :|:.|...||         .||..| |.|    
 Frog   318 ------------------VLNGF---------LTVSRWKIHAGSISLSTGIAYSVRNIYYNGLYS 355

  Fly   238 ------DIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSA-ADVSGWGKTESSGS-SKIK 294
                  |:|||:.:.|:::  .....|||||    |...|...:| ..:.|||.....|. |.:.
 Frog   356 LETNDYDVALLKTTVPMSF--SDTTRPVCLP----RAYQQFQVTANCWIIGWGHVSEGGQLSPVL 414

  Fly   295 QKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYVYL 358
            |:|.:.:.....|..:  .:....::...:|||...| .|||.|||||||..:    .|..: :.
 Frog   415 QEAKVQLISSQICNHS--SNYAGQISPRMLCAGYPDGRADSCQGDSGGPLVCQ----EGGLW-WQ 472

  Fly   359 AGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            .|:||.| :.||.....|:||.::..:||:
 Frog   473 VGIVSWG-EGCGRPNRPGVYTNLTEVLDWV 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 76/279 (27%)
Tryp_SPc 133..391 CDD:238113 76/279 (27%)
LOC100491119XP_004916446.1 SRCR_2 172..269 CDD:373897 2/3 (67%)
Tryp_SPc 275..501 CDD:238113 75/278 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.