DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and LOC100490440

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_002939183.3 Gene:LOC100490440 / 100490440 -ID:- Length:565 Species:Xenopus tropicalis


Alignment Length:315 Identity:71/315 - (22%)
Similarity:105/315 - (33%) Gaps:101/315 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 TCIEKKDCDFYAVDKLME------LASKQQCFSRQRPDLVC-----CPRETNI-----------I 80
            :.:|.:..||.::...||      ..|.:.....|..:||.     |.:|..:           |
 Frog   193 SALEPQSFDFPSMMDYMEGEILQWPRSGEDNVENQCQELVSVFEMPCDQEGLVEFPPYLSILLDI 257

  Fly    81 PPLAPRI-----SN------GTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVG 134
            ||..|.|     ||      |.::...|...:|.|| ....||..:||..|:....|...:.:| 
 Frog   258 PPPVPAIVGVAGSNKDTILHGLSDPPMSGLLVKALP-GPGNPPLPVDQYLENLQLESCDVYLIV- 320

  Fly   135 GHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTD 199
              .:||......||:| ..|:.||                  ||:...|....:   || .::..
 Frog   321 --ESGLNNSFRATLVE-ALVAAGK------------------HCMLIAGEGRQS---GE-EKEPG 360

  Fly   200 PDCE--------NDLNGVR----ECAPPHIRVTIDRILPH--AQYSELNYRN------DIALLRL 244
            .|.|        .||.|::    :.||..:|..:...||.  ||......|.      |:.|   
 Frog   361 HDGEGKRAYLGATDLRGLKVALEKGAPQLVRERLLHCLPSIVAQLVRREQRRIMMGVYDLCL--- 422

  Fly   245 SRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSG----WGKTESSGSSKIKQ 295
                         .||.....|:....||..:|.:|.    :|..|.| .|:|.|
 Frog   423 -------------DVCTKASYGQIPQALASLSAALSSFRSRFGLDEES-ISRIAQ 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829 9/46 (20%)
Tryp_SPc 131..388 CDD:214473 42/189 (22%)
Tryp_SPc 133..391 CDD:238113 42/187 (22%)
LOC100490440XP_002939183.3 P-loop_NTPase 32..218 CDD:422963 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.