DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and hgfac

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_002939269.3 Gene:hgfac / 100485696 XenbaseID:XB-GENE-940012 Length:595 Species:Xenopus tropicalis


Alignment Length:298 Identity:87/298 - (29%)
Similarity:142/298 - (47%) Gaps:63/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LPEHPYCGSAFSFRLV------GGHNTGLFEFPWTTLLEYETVSG---GKDYACGASFIAQRWLL 173
            :|..|.||.....|:|      ||::......||        |:|   | :|.|..|.|...|::
 Frog   332 VPAPPKCGKKHEKRVVARGRILGGNSALPGSHPW--------VAGIYIG-NYFCAGSLIQPCWVV 387

  Fly   174 TAAHCI-HTMGRNLTAAILGE--WNRDTDPDCENDLNGVRECAPPHIRVT----IDRILPHAQYS 231
            :||||. .:..::....:||:  :|:.||                   ||    ::|.:.:.:||
 Frog   388 SAAHCFADSPSKSKIRVVLGQHFFNQTTD-------------------VTQTFEVERYIFYDKYS 433

  Fly   232 ELNYRN--DIALLRLSRPVNWL--QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGK--TESSGS 290
            ... ||  ||.|::|.|..|..  :.|.::.:|||.....:|:.   ....::|||:  .:|:..
 Frog   434 VFK-RNEHDIVLIKLKRINNACAKKTQFVQTICLPDVSAPFADD---HHCQIAGWGRMHEDSTEY 494

  Fly   291 SKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNR 354
            ::..|:|::.:.|.::|........:|  :::..||| .:..:|||.|||||||..|.:..|   
 Frog   495 AQNLQEAIVPLVPDNKCSSPEIYGAEI--SENMFCAGYFDCTIDSCQGDSGGPLACEKDKIS--- 554

  Fly   355 YVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTI 392
              ||.|:||.| :.||.....|:||:||:|:|||...|
 Frog   555 --YLWGIVSWG-EGCGNHNKPGVYTKVSNYVDWINRKI 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 80/279 (29%)
Tryp_SPc 133..391 CDD:238113 81/280 (29%)
hgfacXP_002939269.3 FN2 52..98 CDD:238019
EGF_CA 109..145 CDD:238011
FN1 147..185 CDD:238018
KR 235..319 CDD:294073
Tryp_SPc 351..585 CDD:214473 78/273 (29%)
Tryp_SPc 352..588 CDD:238113 80/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.