DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and zgc:171509

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001307362.1 Gene:zgc:171509 / 100141339 ZFINID:ZDB-GENE-080219-48 Length:240 Species:Danio rerio


Alignment Length:275 Identity:81/275 - (29%)
Similarity:118/275 - (42%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYA-CGASFIAQRWLLTAAHC------IHTMGRNLTA 188
            :::|||.......||...|:       ..|. ||.|.|.:.|:::||||      :|        
Zfish    20 KIIGGHECQPHSQPWQARLD-------DGYGLCGGSLIHESWVVSAAHCKSSSIIVH-------- 69

  Fly   189 AILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRP--VNWL 251
              ||          ::||..|.:.|.   .:..::::.|.:|:...:.|||.|::|..|  :|  
Zfish    70 --LG----------KHDLFVVEDTAQ---EIQAEKVISHPKYNNREHNNDIMLIKLREPAVIN-- 117

  Fly   252 QMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQEAFYKDTK 316
              .|::||.||.....     ||....|||||.|..|.||.: |...|.|..:..|:.|:.:   
Zfish   118 --NNVKPVPLPTNCSH-----AGEQCLVSGWGVTGDSISSTL-QCLELPILSKADCKSAYGR--- 171

  Fly   317 ITLADSQMCAG-GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTR 380
             .:.....||| .:.|.|||.||||||:.....         |.|:||.| ..|....|.|:|..
Zfish   172 -VITKKMFCAGFMDGGKDSCQGDSGGPVVCNGT---------LKGIVSFG-IGCAEPGFPGVYVE 225

  Fly   381 VSSYMDWIESTIRAN 395
            |..|::||...|..|
Zfish   226 VCRYINWINYIIANN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/266 (29%)
Tryp_SPc 133..391 CDD:238113 79/267 (30%)
zgc:171509NP_001307362.1 Tryp_SPc 20..233 CDD:214473 77/266 (29%)
Tryp_SPc 21..234 CDD:238113 78/266 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.