DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and gzma

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:270 Identity:72/270 - (26%)
Similarity:120/270 - (44%) Gaps:58/270 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNR 196
            ::.|........|:...:...|.|      ||.:.|.|.|:||||||:    .|.:..|||    
 Frog    35 IIDGREAASHSRPYMAYIYSRTGS------CGGTLIKQNWVLTAAHCV----VNNSEVILG---- 85

  Fly   197 DTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALL------RLSRPVNWLQMQN 255
                     .:.|:.......|.::.|.:||..:......:||.||      :|::.|:.|::..
 Frog    86 ---------AHKVKSRENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPT 141

  Fly   256 LEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS--SKIKQKAMLHIQPQDQCQEAFYKDTKIT 318
            .:....|           ||:...:|||.|:.:|.  |.:.::..:.:..:..|.: .||..|..
 Frog   142 TDMDVKP-----------GSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTCNK-IYKKFKTE 194

  Fly   319 LADSQMCAG----GEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYT 379
            ::.:.:|||    .:...|:|.|||||||      ..|..:   :|:||.|:| ||...:.||||
 Frog   195 ISTNMLCAGAPKKSDKKYDACQGDSGGPL------ICGKEF---SGIVSFGKK-CGDPKYPGIYT 249

  Fly   380 RVSS-YMDWI 388
            |::: |:.||
 Frog   250 RLTARYLQWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 70/268 (26%)
Tryp_SPc 133..391 CDD:238113 72/269 (27%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 72/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.