DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and tmprss12

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_031751504.1 Gene:tmprss12 / 100127698 XenbaseID:XB-GENE-964846 Length:324 Species:Xenopus tropicalis


Alignment Length:286 Identity:98/286 - (34%)
Similarity:133/286 - (46%) Gaps:35/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GIDQLPEHPYCGS-----AFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLL 173
            ||.|..:...||.     ....|:|||.|.....:||...|:|.....|..:.||.|.|...|:|
 Frog    18 GIIQAIDSEVCGEPPLVHTPGSRIVGGRNALPGAWPWQVSLQYFRTLSGYSHRCGGSLIQNNWVL 82

  Fly   174 TAAHCIHTMGRN--LTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYR 236
            :||||... .||  ...|:||             |:.:.....|.::..|.:|:.||.|..:...
 Frog    83 SAAHCFRA-NRNPEYWRAVLG-------------LHNIFMEGSPVVKAKIKQIIIHASYDHIAIT 133

  Fly   237 NDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGS-SKIKQKAMLH 300
            ||||||.|...|.:  ...:.||||    |......:.:|..::|||.|:..|| |.|.|:|::.
 Frog   134 NDIALLLLHDFVTY--SDYIHPVCL----GSVTVPDSLTACFITGWGVTKEKGSISVILQEALVQ 192

  Fly   301 IQPQDQCQEAFYKDTKITLADSQMCAGGEIG-VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSI 364
            ..|..:|..:...:..||  .|.:|||...| ||||.||||||. |..||.  ....|..|:.|.
 Frog   193 TIPYSECNSSSSYNGFIT--QSMICAGDNSGAVDSCQGDSGGPF-VCYNTE--RMRFYQMGITSF 252

  Fly   365 GRKHCGTALFSGIYTRVSSYMDWIES 390
            | ..||...|.|:||:|.||:.||::
 Frog   253 G-YGCGKPNFPGVYTKVESYVSWIKA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 91/260 (35%)
Tryp_SPc 133..391 CDD:238113 92/262 (35%)
tmprss12XP_031751504.1 Tryp_SPc 41..278 CDD:238113 92/263 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.