DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and LOC100004411

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:322 Identity:100/322 - (31%)
Similarity:152/322 - (47%) Gaps:53/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 SNGTTNATSSTTTL----KLLPRTTPRPPSGI---DQLPEHPYCGSAFS-----FRLVGGHNTGL 140
            :|.|.::||.:..|    ..|..:|.:..:.:   |||.:   .||.|:     .|:|||.....
Zfish   196 ANHTHSSTSPSHPLHHNRSALENSTHQNQTELTAPDQLLD---TGSDFTGGNEDTRIVGGQLQRQ 257

  Fly   141 FEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTDPDCEND 205
            ...||..||..|...|    .||.|.|.|||::|||||:.....::|   :|:::: ..||.:..
Zfish   258 GGSPWQVLLRREDEYG----FCGGSLINQRWVITAAHCLQQTPHHIT---IGDYDK-MRPDKDEQ 314

  Fly   206 LNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYAN 270
                        ::|:::|:||..|.|..:.:|||||.||..|......:  |.|||.  ...|.
Zfish   315 ------------KITVEKIIPHPHYHEYTFDSDIALLYLSSAVTLGPFAS--PACLPD--ANLAE 363

  Fly   271 QL--AGSAADVSGWGKTE-SSGSSKIKQKAMLHIQPQDQCQEAFYKDTKITLADSQMCAGGEI-G 331
            :|  .|....|||||.|. ...||:..:|..|.:..|..|    ...|:..:.|:..|||..: .
Zfish   364 RLMKPGEQGLVSGWGSTHYLQRSSRFLRKVQLPVVEQKSC----INSTEQIITDNMFCAGFLMEE 424

  Fly   332 VDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWIESTIR 393
            :|:|:||||||..|.....     .:|.||||.|.: |.:....|:|||:.:|:.||:..::
Zfish   425 MDACTGDSGGPFIVNYRGT-----WFLTGVVSWGER-CASQGKYGVYTRLGNYLSWIQEEMK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 85/260 (33%)
Tryp_SPc 133..391 CDD:238113 86/261 (33%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 128..164 CDD:291342
Tryp_SPc 248..475 CDD:214473 85/260 (33%)
Tryp_SPc 249..477 CDD:238113 86/261 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.