DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ACA7

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_172287.1 Gene:ACA7 / 837326 AraportID:AT1G08080 Length:275 Species:Arabidopsis thaliana


Alignment Length:269 Identity:75/269 - (27%)
Similarity:121/269 - (44%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRISGLITNTGHSVIFTAGND 101
            ||..||.:.|||.:|.||..|||::|..:|:....:|..::.|.:..:..:.|.||.::      
plant    49 GPERWGELKPEWEMCGKGEMQSPIDLMNERVNIVSHLGRLNRDYNPSNATLKNRGHDIM------ 107

  Fly   102 TVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYAN 166
             :...||..| :.|:|    :.|...::|.|      ..|||::.|..|..|:.:          
plant   108 -LKFEDGAGT-IKING----FEYELQQLHWH------SPSEHTINGRRFALELHM---------- 150

  Fly   167 FSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLPDTD----- 226
            ..:..||...:  |::|.::| .::..:|.|..:||.|  ...|...|.:   |::..|.     
plant   151 VHEGRNRRMAV--VTVLYKIG-RADTFIRSLEKELEGI--AEMEEAEKNV---GMIDPTKIKIGS 207

  Fly   227 -HYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPL-- 288
             .|..|.||.|.|.|.:.|||.|:.|...:|::|:..||..:     |..|  .:|.||.||.  
plant   208 RKYYRYTGSLTTPPCTQNVTWSVVRKVRTVTRKQVKLLRVAV-----HDDA--NSNARPVQPTNK 265

  Fly   289 ----LHRPI 293
                |:|||
plant   266 RIVHLYRPI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 75/269 (28%)
ACA7NP_172287.1 alpha_CA_prokaryotic_like 49..270 CDD:239398 71/263 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.