DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ACA8

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_200444.1 Gene:ACA8 / 835733 AraportID:AT5G56330 Length:350 Species:Arabidopsis thaliana


Alignment Length:274 Identity:60/274 - (21%)
Similarity:105/274 - (38%) Gaps:86/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EDWWTYD--GISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPN---LRPMHIDKHRISGL 86
            |..::|:  |..|||.||.::.||.:|..|:.|||::|..:.::....   ||..::..:.   .
plant   137 ETEFSYETKGNKGPAKWGTLDAEWKMCGIGKMQSPIDLRDKNVVVSNKFGLLRSQYLPSNT---T 198

  Fly    87 ITNTGHSVI--FTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYT 149
            |.|.||.::  |..||..:.        |.|.|    .||:..::|.|      ..|||::.|..
plant   199 IKNRGHDIMLKFKGGNKGIG--------VTIRG----TRYQLQQLHWH------SPSEHTINGKR 245

  Fly   150 FPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVK 214
            |..|..:          ..::.::...:  |:.|..|| .|:..|..|..||::|          
plant   246 FALEEHL----------VHESKDKRYAV--VAFLYNLG-ASDPFLFSLEKQLKKI---------- 287

  Fly   215 RLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLG 279
                      ||.:.:.:...|                  ::.:|:..||..:..:.|       
plant   288 ----------TDTHASEEHIRT------------------VSSKQVKLLRVAVHDASD------- 317

  Fly   280 NNYRPPQPLLHRPI 293
            :|.||.|.:..|.:
plant   318 SNARPLQAVNKRKV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 57/262 (22%)
ACA8NP_200444.1 alpha_CA_prokaryotic_like 149..333 CDD:239398 57/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.