DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ACA6

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_193832.1 Gene:ACA6 / 827847 AraportID:AT4G21000 Length:260 Species:Arabidopsis thaliana


Alignment Length:224 Identity:61/224 - (27%)
Similarity:102/224 - (45%) Gaps:46/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GPAFWGLINPEWSLCNKGRRQSPVNLEPQR--LLFDPNLRPMHIDKHRISGLITNTGHSVIFTAG 99
            |||.||.::|:|.:|:.|:.|||::|..:|  |:.|..|     .||      .....:||.:.|
plant    46 GPAEWGKLDPQWKVCSTGKIQSPIDLTDERVSLIHDQAL-----SKH------YKPASAVIQSRG 99

  Fly   100 NDTVANYDGMQTPVNISGGPLSYR---YRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNS 161
            :|.:.::.|       .||.::..   |:..:.|.|      ..|||::.|.:         |:.
plant   100 HDVMVSWKG-------DGGKITIHQTDYKLVQCHWH------SPSEHTINGTS---------YDL 142

  Fly   162 QLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIR-YGGDEAFVKRLSIRGLLPDT 225
            :|:...:.|..:.. :|||  |.:||:..    ..||..|..|: .|..|..:..:..|.:..:|
plant   143 ELHMVHTSASGKTT-VVGV--LYKLGEPD----EFLTKILNGIKGVGKKEIDLGIVDPRDIRFET 200

  Fly   226 DHYMTYDGSTTAPACHETVTWVVLNKPIY 254
            :::..|.||.|.|.|.|.|.|.|..:.:|
plant   201 NNFYRYIGSLTIPPCTEGVIWTVQKRVLY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 61/224 (27%)
ACA6NP_193832.1 PLN02179 1..235 CDD:177835 61/224 (27%)
alpha_CA_prokaryotic_like 46..225 CDD:239398 60/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.