DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ACA4

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_193831.1 Gene:ACA4 / 827846 AraportID:AT4G20990 Length:267 Species:Arabidopsis thaliana


Alignment Length:270 Identity:74/270 - (27%)
Similarity:113/270 - (41%) Gaps:65/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WTYDGIS--GPAFWGLINPEWSLCNKGRRQSPVNLEPQR--LLFDP----NLRPMHIDKHRISGL 86
            :||:..:  ||..||.|||.|.:||.||.|||::|..:|  |:.|.    ..:|       ...:
plant    36 FTYEQKTEKGPEGWGKINPHWKVCNTGRYQSPIDLTNERVSLIHDQAWTRQYKP-------APAV 93

  Fly    87 ITNTGHSVIFT----AGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEG 147
            |||.||.::.:    ||..|:...|                  |:.:..|:    ...|||:|.|
plant    94 ITNRGHDIMVSWKGDAGKMTIRKTD------------------FNLVQCHW----HSPSEHTVNG 136

  Fly   148 YTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIR-YGGDEA 211
            ..         |:.:|:...:.|..|. .::||  |.:||:.:    ..||..|..|: .|..|.
plant   137 TR---------YDLELHMVHTSARGRT-AVIGV--LYKLGEPN----EFLTKLLNGIKAVGNKEI 185

  Fly   212 FVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKA 276
            .:..:..|.:...|..:..|.||.|.|.|.|.|.|.|:.:...|:.:|:.|||:.:...      
plant   186 NLGMIDPREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQITALRQAVDDG------ 244

  Fly   277 PLGNNYRPPQ 286
             ...|.||.|
plant   245 -FETNSRPVQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 72/261 (28%)
ACA4NP_193831.1 PLN02179 1..226 CDD:177835 65/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.