DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CA8

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001308766.1 Gene:CA8 / 767 HGNCID:1382 Length:290 Species:Homo sapiens


Alignment Length:283 Identity:85/283 - (30%)
Similarity:141/283 - (49%) Gaps:40/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DWWTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRI---SGLITN 89
            :|...:|:.    |||:.|:    ..|..|||:||..:...:||:|..:.:..:.:   ...:||
Human    28 EWGYEEGVE----WGLVFPD----ANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTN 84

  Fly    90 TGHSVIFTAGNDTVANYDGMQTPVNISGGPL--SYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPA 152
            .||::.....:.:|           :|||||  .:.:..:|:..|:|..:|.||||:|....||.
Human    85 DGHTIQVILKSKSV-----------LSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPM 138

  Fly   153 EIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLS 217
            |:.:..:||.|:.:..:|:.:..||..:::.:|:|. .:..|:.:|:.|:.|:|.|....:...:
Human   139 ELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGK-EHVGLKAVTEILQDIQYKGKSKTIPCFN 202

  Fly   218 IRGLLPD--TDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKAP--- 277
            ...||||  ...|..|:||.|.|.|.|.|||::...|:.|::.|:...|||.    .|.|..   
Human   203 PNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLR----THVKGAELV 263

  Fly   278 ------LGNNYRPPQPLLHRPIR 294
                  ||:|:||.|||..|.||
Human   264 EGCDGILGDNFRPTQPLSDRVIR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 83/274 (30%)
CA8NP_001308766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
alpha_CARP_VIII 35..289 CDD:239394 83/276 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145778
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.