DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CA2

DIOPT Version :10

Sequence 1:NP_572581.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_000058.1 Gene:CA2 / 760 HGNCID:1373 Length:260 Species:Homo sapiens


Alignment Length:61 Identity:11/61 - (18%)
Similarity:23/61 - (37%) Gaps:15/61 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSLVMHA----AVITSYFTKPMIVDEEE-----------KMEEKIQEPKKRVAIDQDKLV 46
            |..|:.||    :...:|......::.||           :.:..|.:......::||:|:
Human   278 MKQLLQHANNWLSTHMAYVDNISFLESEEGLIFQPVFKKLRFQHIICDLTSTTILEQDRLI 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_572581.1 alpha_CARP_X_XI_like 37..298 CDD:239395 3/10 (30%)
CA2NP_000058.1 alpha_CA_I_II_III_XIII 1..259 CDD:239393
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.