DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca5b

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001039155.1 Gene:ca5b / 733981 XenbaseID:XB-GENE-1003819 Length:319 Species:Xenopus tropicalis


Alignment Length:246 Identity:78/246 - (31%)
Similarity:124/246 - (50%) Gaps:10/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GRRQSPVNLEPQRLLFDPNLRPMHIDKHRISGL-ITNTGHSVIFTAGNDTVANYDGMQTPVNISG 117
            |.||||:|:..:..:|.|.|.|:|......:.| |.|.|:|..        ..||.......:||
 Frog    63 GSRQSPINIRIRDSVFHPQLAPVHTQYDPNTCLYIWNNGYSFF--------VEYDDSTDKSTVSG 119

  Fly   118 GPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSI 182
            |||...:|..:.|.|:|.|:.:||||:|:...||||:.:..:|...|..|.:|:....|:..:.:
 Frog   120 GPLENPFRLKQFHFHWGRNNDWGSEHTVDSRVFPAELHLVHWNCSKYRTFEEAIMEPNGLAVIGV 184

  Fly   183 LLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWV 247
            .|::|. .:.:|:.|.|.|..:||..............|||....|.||.||.|.|...|:|||:
 Frog   185 FLKVGK-HHEKLQKLVDILPSVRYKDALTEFNYFDSSCLLPSCGDYWTYSGSLTTPPLTESVTWI 248

  Fly   248 VLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNID 298
            ::.|||.:...||...|.|:..:....:..:.:|:||.|||::|.:.::.:
 Frog   249 IMKKPIEVDHSQLAVFRSLLFTAVGEEERYMVDNFRPLQPLMNRTVHSSFE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 78/244 (32%)
ca5bNP_001039155.1 alpha_CA_V 63..298 CDD:239392 78/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.