DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and CA10

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001076002.1 Gene:CA10 / 56934 HGNCID:1369 Length:328 Species:Homo sapiens


Alignment Length:331 Identity:132/331 - (39%)
Similarity:191/331 - (57%) Gaps:30/331 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLLARMQVLLAVS------WEDWWTY-DGISG-----PAFWGLINPEWSLCNKGRRQSPVNLE 63
            |.||.|...|.::..      .|.||.| :.:.|     |:||||:|..|:||:.|:||||||:|
Human     8 LFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIE 72

  Fly    64 PQRLLFDPNLRPMHIDK--HRISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYRF 126
            ...::|||.|.|:.|:.  .::||.:.|||..|......:.:         |||||||::|.:|.
Human    73 TSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHL---------VNISGGPMTYSHRL 128

  Fly   127 HEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLSN 191
            .||.:|:|..|..||||.:.|..|..|:|:..||.:||.|.::|.....|:|.|||.:::.|.||
Human   129 EEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSN 193

  Fly   192 AEL-RMLT-DQLERIRYGGDEAFVKRLSIRGLLPDTDHYMTYDGSTTAPACHETVTWVVLNKPIY 254
            ..| |||. |.:.||.|..|...::.|:|..|.|:|..::|||||.|.|.|:||.:|:::|||:|
Human   194 PFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVY 258

  Fly   255 ITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNIDFKTTKSNGKAACP-TMYREVY 318
            ||:.|:|:||.|.|..|......:.:|:||.|||.:|.|||||:|..   .|| .|| ...:::.
Human   259 ITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSL---QGK-DCPNNRAQKLQ 319

  Fly   319 YKATSW 324
            |:...|
Human   320 YRVNEW 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 115/269 (43%)
CA10NP_001076002.1 alpha_CARP_X_XI_like 46..302 CDD:239395 114/264 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145773
Domainoid 1 1.000 234 1.000 Domainoid score I2391
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H23201
Inparanoid 1 1.050 248 1.000 Inparanoid score I3255
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45680
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0002299
OrthoInspector 1 1.000 - - mtm8599
orthoMCL 1 0.900 - - OOG6_106561
Panther 1 1.100 - - LDO PTHR18952
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8915
SonicParanoid 1 1.000 - - X1354
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.