DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca7

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_957107.1 Gene:ca7 / 564201 ZFINID:ZDB-GENE-040426-1786 Length:263 Species:Danio rerio


Alignment Length:273 Identity:99/273 - (36%)
Similarity:153/273 - (56%) Gaps:17/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WTYDGISGPAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRISGL-ITNTGHS 93
            |.|...:||:.|   :.::.:. :|.||||:::.|...:||..|.|:.:..:..:.| |:|.|||
Zfish     6 WGYGEDNGPSAW---HKDYPIA-EGNRQSPIDIVPSEAVFDSKLSPISLSYNNCTSLSISNNGHS 66

  Fly    94 VIFTAGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFG 158
            |:       |...|..:..| |:||||...||..:.|.|:|.....||||:|.|.||.:|:.:..
Zfish    67 VV-------VEFVDTDERSV-ITGGPLENMYRLKQFHFHWGSKGCCGSEHTVAGKTFVSELHLVH 123

  Fly   159 YNSQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSIRGLLP 223
            :|:..|.:||:|.....|:..:.|.|:.||...| |..:||.|..:|:.|..|..|..:.:.|||
Zfish   124 WNANKYKSFSEAAAAPDGLAVLGIFLETGDEHRA-LHQITDALYMVRFKGSLAEFKGFNPKCLLP 187

  Fly   224 DTDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLM-QGSPDHPKAPLGNNYRPPQP 287
            ::..|.||.||.|.|..:|:|||:||.:|||::::|:...|.|: .|..:..:..:.||||||||
Zfish   188 NSLEYWTYPGSLTTPPLYESVTWIVLKEPIYVSEKQMGKFRTLLFNGEEEEDRNRMENNYRPPQP 252

  Fly   288 LLHRPIRTNIDFK 300
            |..|.:|.:  ||
Zfish   253 LKGRMVRAS--FK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 95/262 (36%)
ca7NP_957107.1 alpha_CA_VII 26..262 CDD:239402 92/246 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579227
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.