DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CARPB and ca4a

DIOPT Version :9

Sequence 1:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster
Sequence 2:NP_001107879.2 Gene:ca4a / 555196 ZFINID:ZDB-GENE-080204-85 Length:306 Species:Danio rerio


Alignment Length:297 Identity:84/297 - (28%)
Similarity:134/297 - (45%) Gaps:39/297 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQALCCTLLLLLARMQVLLAVSWEDWWTYDGIS------GPAFWGLINPEWSLCNKGRRQSPVNL 62
            ::.|....||.|    :|.|.:..||.....:|      ||..|..:|.:   |.|. ||||:|:
Zfish     1 MRCLLSAYLLPL----ILHACTGADWCYQTQVSCDSHCKGPEKWREVNAD---CGKD-RQSPINI 57

  Fly    63 EPQRLLFDPNLRPMHIDKHR--ISGLITNTGHSVIFTAGNDTVANYDGMQTPVNISGGPLSYRYR 125
            ..::...|..|.|.....::  ..|.:.|.||||..:           :..|..||||.|:..|:
Zfish    58 VTKQTKLDERLTPFRFTGYQTVFDGTLKNNGHSVQVS-----------IPVPATISGGNLAEPYK 111

  Fly   126 FHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSILLQLGDLS 190
            ..:.|:|:|::...||||:::|..:|.|:.|. :..|.|....|||....|:..:....::...:
Zfish   112 AVQFHLHWGISSGPGSEHTIDGEQYPMELHIV-HMKQKYIRIEDALKDPSGVAVLGFFYEVSSTT 175

  Fly   191 NAELRMLTDQLERIRYGGDEAFVKRLSIRGL-LPDTD--HYMTYDGSTTAPACHETVTWVVLNKP 252
            |.:..:....|..::.......::::|:..| ||:.:  :|..||||.|.|.|.|.|.|.|..||
Zfish   176 NRKYDLFAHALRSVQNTNGNTTLRKISLNQLILPEVNMTNYYRYDGSLTTPGCTEAVVWTVFEKP 240

  Fly   253 IYITKQQLHALRRL--MQGSPDHPKAPLGNNYRPPQP 287
            |.:..:||.|...|  ..|.      |:...:||.||
Zfish   241 IPLDSEQLQAFSSLKFRDGK------PMVGTFRPVQP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 75/258 (29%)
ca4aNP_001107879.2 alpha_CA_IV_XV_like 49..279 CDD:239391 70/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.